PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00019.1.g02130.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 445aa    MW: 46084.3 Da    PI: 10.8822
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00019.1.g02130.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.61.8e-35285341460
                        zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                   +  +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+ +
  Zjn_sc00019.1.g02130.1.am.mk 285 QGEQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKRPR 341
                                   5679*************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.5E-31286339IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.559287341IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-23288334IPR003851Zinc finger, Dof-type
PROSITE patternPS013610289325IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MPCKGPGRGQ QHARRWNAPS SGVVPDRSRC MATESAAYAG AHSGARRLLL LPAGIGVGAG  60
RSAAGGCCRL LGIGGGRLPA FVRRPDVTGR VKGCRRPSLL PGPMVLASSC RRDEEATGGS  120
RTARRVRLGC GLRPGAHGSD KNTSATAVLA MEWMDPTRTA ILSGVVWRPE DDRQMMEGLA  180
PGLHGKLRLF SGSTSARAHL SRPAKTSTTM AGQQAPVSLA QLQANDKICD HLGTPAAATM  240
SASVSCGAAT TTTTAAEMAY LRQLQLQQAA DANNSNNGNG GGGSQGEQCP RCASHDTKFC  300
YYNNYNTSQP RHFCRACRRY WTLGGSLRNV PIGGSTRKRP RFAHPPRRHP PAAHVGRGGA  360
GFDLGLGLTV PGGAAFGGAG EMQGLGVRGG LGGTSALLWP AGLLDSDSVD VWKAPGVGAA  420
MWPEFSAAAA PPQTSGLLHG GVQLM
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824064e-77KC582406.1 Sorghum bicolor dof9 protein (dof9) gene, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6343922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-24DOF zinc finger protein 1